
LociOiling's dihydrofolate reductase from puzzle 1461.
143: Rosetta Decoy 7 is a revisiting puzzle, originally presented as 143: Rosetta Decoy 7 in 2009.
This puzzle was the seventh in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.
The puzzle protein has been solved, and is identified as dihydrofolate reductase, an enzyme that helps bacteria resist certain antibiotics, among other functions.
The puzzle protein has 56 segments with the sequence:
atfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaleri
This sequence is found in these Protein Data Bank entries:
- 1VIE (chain A, offset 5)
- 1VIF (chain A, offset 5)
- 2GQV (chain A, offset 5)
- 2RH2 (chain A, offset 5)
- 2RK1 (chain A, offset 5)
- 2RK2 (chain A, offset 5)
- 3SFM (chain A, offset 5)
The puzzle protein does not form disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
143: Rosetta Decoy 7 | 05/13/09 | 9,270 | Steven Pletsch | 9,278 | csohad | 9,278 | Another Hour Another Point | |
1009: Revisiting Puzzle 143: Rosetta Decoy 7 | 11/12/14 | 8,568 | retiredmichael | 8,565 | Galaxie | 8,568 | Beta Folders | |
1210: Revisiting Puzzle 143: Rosetta Decoy 7 | 03/30/16 | 8,912 | LociOiling | 8,949 | smilingone | 8,949 | Beta Folders | |
1461: Revisiting Puzzle 143: Rosetta Decoy 7 | 12/26/17 | 8,927 | LociOiling | 8,926 | LociOiling | 8,927 | Beta Folders | |
1919: Revisiting Puzzle 143: Rosetta Decoy 7 | 11/26/20 | 9,846 | LociOiling | 9,848 | LociOiling | 9,848 | Beta Folders |