140: Rosetta Decoy 4 is a revisiting puzzle, originally presented as Puzzle 140: Rosetta Decoy 4 in 2009.
This puzzle was the fourth in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.
The puzzle protein has been solved, and is identified as human glutaredoxin-2.
The puzzle protein has 101 segments with the sequence:
mpvnqiqetisdncvvifsktscsyctmakklfhdmnvnykvveldlleygnqfqdalykmtgertvprifvngtfiggatdthrlhkegkllplvhqcyl
This sequence is found in these Protein Data Bank entries:
- 2CQ9 (chains A, offset 14)
- 2HT9 (chains A, B; offset 36)
- 2FLS (chains A, offset 22, model offset 14)
Both 2CQ9 and 2HT9 are missing the starting methionine that's seen in the Foldit puzzle.
The methionine is present in 2FLS. The FASTA sequence shown for PDB entry 2FLS doesn't match the actual model. Segment 1 of the Foldit sequence is residue 23 of the FASTA sequence, an offset of 22. If you open 2FLS in a protein viewer, you'll find the first residue or segment is numbered 15, an offset of 14.
The puzzle protein can have one disulfide bridges, identified in 2FLS a as 28-113, using the model numbering. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridge in this format:
14,99
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
140: Rosetta Decoy 4 | 04/30/09 | 10,467 | vertex | 10,461 | gdnskye | 10,467 | Richard Dawkins Foundation | |
997: Revisiting Puzzle 140: Rosetta Decoy 4 | 10/21/14 | 9,974 | retiredmichael | 9,973 | LociOiling | 9,974 | Beta Folders | |
1201: Revisiting Puzzle 140: Rosetta Decoy 4 | 03/09/16 | 10,012 | LociOiling | 10,013 | smilingone | 10,013 | Beta Folders | |
1429: Revisiting Puzzle 140: Rosetta Decoy 4 | 09/20/17 | 9,991 | LociOiling | 9,988 | reefyrob | 9,991 | Beta Folders | |
1911: Revisiting Puzzle 140: Rosetta Decoy 4 | 11/06/20 | 11,581 | LociOiling | 11,580 | LociOiling | 11,581 | Beta Folders | |
2161: Revisiting Puzzle 140: Rosetta Decoy 4 | 06/23/22 | 11,618 | LociOiling | 11,625 | Galaxie | 11,625 | Anthropic Dreams | |
2414: Revisiting Puzzle 140: Rosetta Decoy 4 | 02/14/24 | 11,692 | LociOiling | 11,700 | Galaxie | 11,700 | Anthropic Dreams |