Foldit Wiki
Advertisement

LociOiling's glutaredoxin-2 from puzzle 1429.

140: Rosetta Decoy 4 is a revisiting puzzle, originally presented as Puzzle 140: Rosetta Decoy 4 in 2009.

This puzzle was the fourth in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.

The puzzle protein has been solved, and is identified as human glutaredoxin-2.

The puzzle protein has 101 segments with the sequence:

mpvnqiqetisdncvvifsktscsyctmakklfhdmnvnykvveldlleygnqfqdalykmtgertvprifvngtfiggatdthrlhkegkllplvhqcyl

This sequence is found in these Protein Data Bank entries:

  • 2CQ9 (chains A, offset 14)
  • 2HT9 (chains A, B; offset 36)
  • 2FLS (chains A, offset 22, model offset

14)

Both 2CQ9 and 2HT9 are missing the starting methionine that's seen in the Foldit puzzle.

The methionine is present in 2FLS. The FASTA sequence shown for PDB entry 2FLS doesn't match the actual model. Segment 1 of the Foldit sequence is residue 23 of the FASTA sequence, an offset of 22. If you open 2FLS in a protein viewer, you'll find the first residue or segment is numbered 15, an offset of 14.

The puzzle protein can have one disulfide bridges, identified in 2FLS a as 28-113, using the model numbering. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridge in this format:

14,99

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
140: Rosetta Decoy 4 04/30/09 10,467 vertex 10,461 gdnskye 10,467 Richard Dawkins Foundation
997: Revisiting Puzzle 140: Rosetta Decoy 4 10/21/14 9,974 retiredmichael 9,973 LociOiling 9,974 Beta Folders
1201: Revisiting Puzzle 140: Rosetta Decoy 4 03/09/16 10,012 LociOiling 10,013 smilingone 10,013 Beta Folders
1429: Revisiting Puzzle 140: Rosetta Decoy 4 09/20/17 9,991 LociOiling 9,988 reefyrob 9,991 Beta Folders
1911: Revisiting Puzzle 140: Rosetta Decoy 4 11/06/20 11,581 LociOiling 11,580 LociOiling 11,581 Beta Folders
Advertisement