Enzyme's human TRP14 from puzzle 1418.
137: Rosetta Decoy is a revisiting puzzle, originally presented as Puzzle 137: Rosetta Decoy in 2009.
This puzzle was the first in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.
The puzzle protein has been solved, and is identified as human thioredoxin-related protein 14, or TRP14 for short. Thioredoxins in general are enzymes with many functions, and have a characteristic thioredoxin fold.
The puzzle protein has 119 segments with the sequence:
yeevsvsgfeefhraveqhngktifayftgskdaggkswcpdcvqaepvvreglkhisegcvfiycqvgekpywkdpnndfrknlkvtavptllkygtpqklveseclqanlvemlfse
This sequence is found in these Protein Data Bank entries:
- 1WOU (chain A, offset 3)
The puzzle protein can have one disulfide bridges, identified in 1WOU a as 43-46. Unlike other revisiting puzzles, the most recent visits to this puzzle have not awarded a bonus for the bridge. The puzzle comments state:
The protein is modeled here in the reduced state, so no disulfides are expected to form.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridge in this format:
40,43
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 137: Rosetta Decoy | 04/17/09 | 10,923 | tallguy-13088 | 10,940 | Milward | 10,940 | Void Crushers | |
| 987b: Revisiting Puzzle 137: Rosetta Decoy | 09/30/14 | 10,053 | BitSpawn | 10,065 | Galaxie | 10,065 | Anthropic Dreams | |
| 1192: Revisiting Puzzle 137: Rosetta Decoy | 02/17/16 | 9,928 | gitwut | 9,934 | Bletchley Park | 9,934 | Contenders | |
| 1418: Revisiting Puzzle 137: Rosetta Decoy | 08/24/17 | 10,024 | Enzyme | 10,033 | actiasluna | 10,033 | Gargleblasters | |
| 1677: Revisiting Puzzle 137: Rosetta Decoy | 05/29/19 | 11,904 | LociOiling | 11,903 | smilingone | 11,904 | Beta Folders | |
| 1893: Revisiting Puzzle 137: Rosetta Decoy | 09/25/20 | 11,784 | LociOiling | 11,789 | LociOiling | 11,789 | Beta Folders | |
| 2140: Revisiting Puzzle 137: Rosetta Decoy | 05/05/22 | 11,903 | LociOiling | 11,895 | Galaxie | 11,903 | Anthropic Dreams | |
| 2405: Revisiting Puzzle 137: Rosetta Decoy | 01/26/25 | 12,018 | LociOiling | 12,015 | Galaxie | 12,018 | Anthropic Dreams |