FANDOM


Irc 455069 1454522399 S1 retiredmichael

retiredmichael's hypothetical protein from puzzle 1186.

135: E. coli is a revisiting puzzle, originally presented as Puzzle 135: E-Coli in 2009.

This one is described as "hypothetical protein dimer encoded by the Yoag gene from Escherichia coli".

Escherichia coli is of course better known as E. coli, the bacterium most commonly tricked into making the other proteins found in the PDB.

A "hypothetical protein" has been identified from an organism's DNA, but it's structure and function is unknown.

A dimer consists of two identical copies of a protein. Only one of copy of the protein is present in the Foldit puzzle.

Although the PDB entry for this protein was released in 2004, the supporting article is still shown as "to be published".

The puzzle protein has 60 segments with the sequence:

mgkatytvtvtnnsngvsvdyetetpmtllvpevaaevikdlvntvrsydtenehdvcgw

This sequence is found in this Protein Data Bank entry:

  • 1NEI (chains A, B; offset 0)

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
135: E-Coli 04/07/09 9,368 Milward 9,362 bzipitidoo 9,368 Void Crushers
1186: Revisiting Puzzle 135: E. coli 02/03/16 8,923 retiredmichael 8,922 phi16 8,923 Beta Folders
1409: Revisiting Puzzle 135: E. coli 08/03/17 8,924 markm457 8,926 Galaxie 8,926 Anthropic Dreams
1671: Revisiting Puzzle 135: E. coli 05/14/19 9,791 retiredmichael 9,807 LociOiling 9,807 Beta Folders
1854: Revisiting Puzzle 135: E. Coli 06/26/20 9,744 Xartos 9,752 ichwilldiesennamen 9,762 Go Science
Community content is available under CC-BY-SA unless otherwise noted.