Foldit Wiki
Advertisement

Enzyme's ethanolamine utilization protein from puzzle 1403.

126: Ethanolamine Utilization is a revisiting puzzle, originally presented in 2009 as 126: Ethanolamine Utilization Puzzle.

The puzzle protein lets the bacterium E. coli use ethanolamine to build cell membranes. Ethanolamine combines an alcohol (ethanol) with an amine group (a nitrogen atom with attached hydrogens). Ethanolamine is a type of amino alcohol, and is derived from the amino acid serine.

The puzzle has 95 segments with the sequence:

mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsgssarqahksetspvdlcvigivdevvsggqvifhk

This sequence is found in these Protein Data Bank entries:

  • 2HD3. (chains A-L, offset 0)
  • 2Z9H. (chains A-F, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
126: Ethanolamine Utilization Puzzle 02/20/09 9,963 Simek 10,028 Madde 10,028 Void Crushers
974: Revisiting Puzzle 126: Ethanolamine Utilization 09/01/14 9,114 wisky 9,128 Galaxie 9,128 Anthropic Dreams
1181: Revisiting Puzzle 126: Ethanolamine Utilization 01/20/16 9,412 LociOiling 9,410 smilingone 9,412 Beta Folders
1403: Revisiting Puzzle 126: Ethanolamine Utilization 07/20/17 9,289 Enzyme 9,313 smilingone 9,313 Beta Folders
1666: Revisiting Puzzle 126: Ethanolamine Utilization 04/30/19 10,905 LociOiling 10,890 LociOiling 10,905 Beta Folders
1848: Revisiting Puzzle 126: Ethanolamine Utilization 06/12/20 10,920 LociOiling 10,918 Angus 10,920 Beta Folders
Advertisement