The eelpout AFP 1B7K, as seen in JMol.
Ice Binding is a revisiting puzzle, originally presented in 2009 as Puzzle 125: Ice Binding.
The puzzle involves an antifreeze protein (AFP) from the fish Zoarces americanus, the largest member of the eelpout family. The protein binds to ice to help protect the fish from freezing.
The puzzle has 66 segments with the sequence:
anqasvvanqlipintaltlvmmrsevvtpvgipaediprlvsmqvnhavplgttlmpdmvkgyaa
This sequence is found in this Protein Data Bank entry:
- 1B7K. (chain A, offset 0)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
Unfortunately, no one has posted images of this protein from previous revisits! An image of PDB entry 1B7K as seen in the protein viewer Jmol was used for this page.