Foldit Wiki
Don't have an account?
Register
Register
in: Revisiting Puzzle

Changes: Revisiting puzzle/125: Ice Binding

< Revisiting puzzle
Back to page
Edit
(New page.)
 
(Start moving results.)
(3 intermediate revisions by the same user not shown)
Line 1: Line 1:
 
[[File:Pdb_1b7k.png|thumb|400px|The eelpout AFP [https://www.rcsb.org/structure/1b7k 1B7K], as seen in JMol.]]
  
[[File:Pdb_1b7k.png|thumb|400px|The eelpout AFP [https://www.rcsb.org/structure/1b7k 1B7K], as seen in JMol.]]
−
[[Revisiting_puzzle/Ice Binding|Ice Binding]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2009 as [https://fold.it/portal/node/960281 Puzzle 125: Ice Binding].
 +
[[Revisiting_puzzle/125: Ice Binding|125: Ice Binding]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2009 as [https://fold.it/portal/node/960281 Puzzle 125: Ice Binding].
   
 
The puzzle involves an antifreeze protein (AFP) from the fish ''Zoarces americanus'', the largest member of the [[wikipedia:Eelpout|eelpout]] family. The protein binds to ice to help protect the fish from freezing.
  
The puzzle involves an antifreeze protein (AFP) from the fish ''Zoarces americanus'', the largest member of the [[wikipedia:Eelpout|eelpout]] family. The protein binds to ice to help protect the fish from freezing.
  +
  +
The same protein also appears in the [[Revisiting_puzzle/75: Antifreeze_Protein|75: Antifreeze Protein]] puzzle.
   
 
The puzzle has 66 segments with the sequence:
  
The puzzle has 66 segments with the sequence:
Line 16: Line 18:
 
This puzzle has a single [[Chain|chain]].
  
This puzzle has a single [[Chain|chain]].
   
−
Unfortunately, no one has posted images of this protein from previous revisits! An image of PDB entry 1B7K as seen in the protein viewer Jmol was used for this page.
 +
Unfortunately, no one has posted images of this protein from previous revisits! An image of PDB entry 1B7K as seen in the protein viewer Jmol was used for this page. See [[Revisiting_puzzle/Antifreeze_Protein|Antifreeze Protein]] for more images.
  +
{| class="wikitable"
  +
|-
  +
!puzzle
  +
!closed
  +
!top solo score
  +
!top solo
  +
!top evo score
  +
!top evo
  +
!top group score
  +
!top group
  +
!comments
  +
|-
  +
|[https://fold.it/portal/node/960281 125: Ice Binding]
  +
|02/13/09
  +
|9,705
  +
|DisposableHeart
  +
|9,708
  +
|Madde
  +
|9,708
  +
|Void Crushers
  +
|
  +
|-
  +
|[https://fold.it/portal/node/998328 970: Revisiting Puzzle 125: Ice Binding]
  +
|08/24/14
  +
|8,795
  +
|mirp
  +
|8,796
  +
|gloverd
  +
|8,796
  +
|Go Science
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2001723 1178: Revisiting Puzzle 125: Ice Binding]
  +
|01/13/16
  +
|9,014
  +
|diamond_dust
  +
|9,014
  +
|diamond_dust
  +
|9,014
  +
|Go Science
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2003918 1400: Revisiting Puzzle 125: Ice Binding Protein]
  +
|07/13/17
  +
|9,026
  +
|O Seki To
  +
|9,022
  +
|O Seki To
  +
|9,026
  +
|Hun-Magyar Csapat
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2007694 1663: Revisiting Puzzle 125: Ice Binding Protein]
  +
|04/16/19
  +
|10,167
  +
|retiredmichael
  +
|10,169
  +
|LociOiling
  +
|10,169
  +
|Beta Folders
  +
|
  +
|}
 
[[Category:Revisiting Puzzle]]
  
[[Category:Revisiting Puzzle]]

Revision as of 02:53, 19 March 2020

Pdb 1b7k

The eelpout AFP 1B7K, as seen in JMol.

125: Ice Binding is a revisiting puzzle, originally presented in 2009 as Puzzle 125: Ice Binding.

The puzzle involves an antifreeze protein (AFP) from the fish Zoarces americanus, the largest member of the eelpout family. The protein binds to ice to help protect the fish from freezing.

The same protein also appears in the 75: Antifreeze Protein puzzle.

The puzzle has 66 segments with the sequence: 

anqasvvanqlipintaltlvmmrsevvtpvgipaediprlvsmqvnhavplgttlmpdmvkgyaa

This sequence is found in this Protein Data Bank entry:

  • 1B7K. (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

Unfortunately, no one has posted images of this protein from previous revisits! An image of PDB entry 1B7K as seen in the protein viewer Jmol was used for this page. See Antifreeze Protein for more images.

puzzle closed top solo score top solo top evo score top evo top group score top group comments
125: Ice Binding 02/13/09 9,705 DisposableHeart 9,708 Madde 9,708 Void Crushers
970: Revisiting Puzzle 125: Ice Binding 08/24/14 8,795 mirp 8,796 gloverd 8,796 Go Science
1178: Revisiting Puzzle 125: Ice Binding 01/13/16 9,014 diamond_dust 9,014 diamond_dust 9,014 Go Science
1400: Revisiting Puzzle 125: Ice Binding Protein 07/13/17 9,026 O Seki To 9,022 O Seki To 9,026 Hun-Magyar Csapat
1663: Revisiting Puzzle 125: Ice Binding Protein 04/16/19 10,167 retiredmichael 10,169 LociOiling 10,169 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.