FANDOM


Irc 215720 1398985989 S1 pauldunn

Paul Dunn's PDZ Domain from puzzle 882.

PDZ Domain is a revisiting puzzle, originally presented as Puzzle 124: PDZ Domain Protein in 2009.

The protein in this puzzle is an example of a PDZ domain, a common component of many larger proteins. There are about 260 PDZ domains in humans, found in about 180 unique proteins. (Some proteins have more than one PDZ domain.)

PDZ domains bind to other proteins and help to organize signalling complexes at cellular membranes.

The protein in this puzzle appears part of the human PICK1 protein, although it's not an exact match to any PDB entries, as described in detail below.

The puzzle protein has 91 segments with the sequence:

smvpgkvtlqkdaqnligisigggaqpclyivqvfdntpaaldgtvaagdeitgvngrsikgktkvevakmiqevkgevtihynklqyykv

A partial match for his sequence is found in this Protein Data Bank entry:

  • 2GZV (chain A, offset 21)

The matching sequence in 2GZV has two segments not found in the Foldit protein. The extra tyrosine and cysteine are shown as YC in this sequence:

smvpgkvtlqkdaqnligisigggaqYCpclyivqvfdntpaaldgtvaagdeitgvngrsikgktkvevakmiqevkgevtihynklqyykv

PDB 2GZV is the closest match to the puzzle protein, but other PDB entries such as 2LUI, 2PKU, 6AR4, 6BJO, and 6BJN are similar, matching fewer segments of the puzzle protein. All of these partial matches contain the extra YC segments, and all are identified as being part of PICK1.

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
124: PDZ Domain Protein 02/06/09 10,139 monteecristo 10,178 Madde 10,178 Void Crushers
882: Revisiting Puzzle 124: PDZ Domain 05/01/14 9,289 pauldunn 9,329 gloverd 9,329 Go Science
1176: Revisiting Puzzle 124: PDZ Domain 01/06/16 9,447 mimi 9,453 gitwut 9,453 Contenders
1397: Revisiting Puzzle 124: PDZ Domain 07/06/17 9,461 eusair 9,469 LociOiling 9,469 Beta Folders
1660: Revisiting Puzzle 124: PDZ Domain 04/16/19 10,984 robgee 11,000 Galaxie 11,000 Galaxie
1842: Revisiting Puzzle 124: PDZ Domain 05/29/20 10,977 Bruno Kestemont 10,976 Galaxie 10,977 Go Science
Community content is available under CC-BY-SA unless otherwise noted.