Timo van der Laan's exocyst protein from puzzle 873.
115: Exocyst is a revisiting puzzle, originally presented as Puzzle 115: Exocyst Complex in 2008.
The protein in this puzzle is involved in exocytosis, the process which moves molecules from the inside to the outside of a cell.
This protein is a beta barrel, basically a tube formed out of sheets. ("Beta" sheets.)
Membrane proteins like the one in the puzzle follow different rules than the globular proteins found inside a cell. Membrane proteins are difficult to study. Normal lab techniques involve growing proteins inside bacteria, but this environment doesn't work well for membrane proteins.
The puzzle protein has 95 segments with the sequence:
hmrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcrvgqakndkgdiivttksggkgtstvsfkllkpek
This sequence is found in this Protein Data Bank entry:
- 1HK6 (chain A, offset 0)
The puzzle protein does not form disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See screenshots of players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 115: Exocyst Complex | 12/19/08 | 10,469 | DisposableHeart | 10,472 | Nicky666 | 10,469 | Another Hour Another Point | |
| 873: Revisiting Puzzle 115: Exocyst | 04/16/14 | 9,459 | Timo van der Laan | 9,483 | smilingone | 9,483 | Beta Folders | |
| 1170: Revisiting Puzzle 115: Exocyst | 12/23/15 | 9,601 | Bruno Kestemont | 9,638 | smilingone | 9,638 | Beta Folders | |
| 1391: Revisiting Puzzle 115: Exocyst | 06/22/17 | 9,630 | dcrwheeler | 9,614 | Blipperman | 9,614 | Gargleblasters | |
| 1654: Revisiting Puzzle 115: Exocyst | 04/01/19 | 11,070 | smilingone | 11,312 | LociOiling | 11,312 | Beta Folders | |
| 1836: Revisiting Puzzle 115: Exocyst | 05/15/20 | 11,070 | Tygh | 11,115 | Galaxie | 11,115 | Anthropic Dreams | |
| 2113: Revisiting Puzzle 115: Exocyst | 03/03/22 | 11,146 | LociOiling | 11,136 | LociOiling | 11,146 | Beta Folders | |
| 2379: Revisiting Puzzle 115: Exocyst | 11/22/23 | 11,222 | Sandrix72 | 11,221 | Sandrix72 | 11,222 | Go Science | Hat trick, Sandrix72! |