FANDOM


Irc 308854 1397689282 S1 Timo van der Laan

Timo van der Laan's exocyst protein from puzzle 873.

115: Exocyst is a revisiting puzzle, originally presented as Puzzle 115: Exocyst Complex in 2008.

The protein in this puzzle is involved in exocytosis, the process which moves molecules from the inside to the outside of a cell.

This protein is a beta barrel, basically a tube formed out of sheets. ("Beta" sheets.)

Membrane proteins like the one in the puzzle follow different rules than the globular proteins found inside a cell. Membrane proteins are difficult to study. Normal lab techniques involve growing proteins inside bacteria, but this environment doesn't work well for membrane proteins.

The puzzle protein has 95 segments with the sequence:

hmrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcrvgqakndkgdiivttksggkgtstvsfkllkpek 

This sequence is found in this Protein Data Bank entry:

  • 1HK6 (chain A, offset 0)

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See screenshots of players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
115: Exocyst Complex 12/19/08 10,469 DisposableHeart 10,472 Nicky666 10,469 Another Hour Another Point
873: Revisiting Puzzle 115: Exocyst 04/16/14 9,459 Timo van der Laan 9,483 smilingone 9,483 Beta Folders
1170: Revisiting Puzzle 115: Exocyst 12/23/15 9,601 Bruno Kestemont 9,638 smilingone 9,638 Beta Folders
1391: Revisiting Puzzle 115: Exocyst 06/22/17 9,630 dcrwheeler 9,614 Blipperman 9,614 Gargleblasters
1654: Revisiting Puzzle 115: Exocyst 04/01/19 11,070 smilingone 11,312 LociOiling 11,312 Beta Folders
1836: Revisiting Puzzle 115: Exocyst 05/15/20 11,070 Tygh 11,115 Galaxie 11,115 Anthropic Dreams
Community content is available under CC-BY-SA unless otherwise noted.