FANDOM


Irc 352715 1497554992 S1 Galaxie 10294

Galaxie's black mamba toxin from puzzle 1388.

114: Black Mamba is a revisiting puzzle, originally presented as Puzzle 114: Black Mamba in 2008.

The toxin in this puzzle is from the venom of the black mamba, Dendroaspis polylepis polylepis. The long list of symptoms of a black mamba bite include ptosis, bulbar palsy, miosis, paresthesia, dysarthria, dysphagia, dyspnea, fasciculations, ataxia, vertigo, and goosebumps.

The puzzle protein has 80 segments with the sequence:

avitgacerdlqcgkgtccavslwiksvrvctpvgtsgedchpashkipfsgqrmhhtcpcapnlacvqtspkkfkclsk

This sequence is found in these Protein Data Bank entries:

  • 1IMT (chain A, offset 0)

The puzzle protein can have five disulfide bridges, identified in 1IMT as 7-19, 13-31, 18,59, 41-67, and 61-77. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

7,19 13,31 18,59 41,67 61,77

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
114: Black Mamba 12/19/08 9,612 Steven Pletsch 9,721 jandersonlee 9,271 Void Crushers
869: Revisiting Puzzle 114: Black Mamba 04/09/14 8,935 karstenw 8,981 Galaxie 8,981 Anthropic Dreams
1167: Revisiting Puzzle 114: Black Mamba 12/16/16 10,231 Timo van der Laan 10,241 smilingone 10,241 Beta Folders
1388: Revisiting Puzzle 114: Black Mamba 06/15/17 10,294 Galaxie 10,297 Galaxie 10,297 Anthropic Dreams
1651: Revisiting Puzzle 114: Black Mamba 03/27/19 11,249 LociOiling 11,251 smilingone 11,251 Beta Folders
1833: Revisiting Puzzle 114: Black Mamba 05/08/20 11,268 dcrwheeler 11,271 dhallion 11,271 Go Science
Community content is available under CC-BY-SA unless otherwise noted.