FANDOM


Irc 434770 1396479942 S1 KarenCH

KarenCH's allergen from puzzle 865.

113: White Birch is a revisiting puzzle, originally presented as Puzzle 113: White Birch in 2008.

The protein in this puzzle is an allergen found in the pollen of the white birch tree, Betula pendula.

The puzzle protein has 84 segments with the sequence:

addhpqdkaererifkrfdangdgkisaaelgealktlgsitpdevkhmmaeidtdgdgfisfqeftdfgranrgllkdvakif 

This sequence is found in this Protein Data Bank entry:

  • 1H4B (chain A, offset 0)

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
113: White Birch 12/12/08 10,120 DisposableHeart 10,179 Mike Cassidy 10,179 Void Crushers
865: Revisiting Puzzle 113: White Birch 04/02/14 9,409 KarenCH 9,414 jamiexq 9,414 Anthropic Dreams
1164: Revisiting Puzzle 113: White Birch 12/09/15 9,602 Bruno Kestemont 9,609 gloverd 9,609 Go Science
1385: Revisiting Puzzle 113: White Birch 06/08/17 9,570 retiredmichael 9,582 LociOiling 9,582 Beta Folders
1648: Revisiting Puzzle 113: White Birch 03/10/19 10,906 grogar7 10,907 Galaxie 10,907 Anthropic Dreams
Community content is available under CC-BY-SA unless otherwise noted.