FANDOM


Irc 476462 1394670192 S1 LociOiling

LociOiling's troponin-C from puzzle 855.

110: Turkey is a revisiting puzzle, originally presented as Puzzle 110: Turkey in 2008.

The protein in this puzzle is a component of troponin, a muscle protein, from Meleagris gallopavo, a species which includes both domestic and wild turkeys.

The same troponin component, troponin C, is seen in the Calcium Ion Binding Protein revisiting puzzle.

The puzzle protein has 76 segments with the sequence:

aflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsgtidfeeflvmmvrqmk

(In the Calcium Ion Binding Protein puzzle, the protein includes the additional segments "qaear" at the start.)

This sequence is found in this Protein Data Bank entries:

  • 5TNC (chain A, offset 11)
  • 4TNC (chain A, offset 11)
  • 2W4U (chains 0, 3, 6, 9, offset 8)
  • 2W49 (chains 0, 3, 6, 9, offset 8)
  • 1ZAC (chain A, offset 11)
  • 1YV0 (chain C, offset 11)
  • 1YTZ (chain C, offset 11)
  • 1TOP (chain A, offset 11)
  • 1TNX (chain A, offset 11)
  • 1TNW (chain A, offset 11)
  • 1TNQ (chain A, offset 11)

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.