FANDOM


Irc 476462 1394670192 S1 LociOiling

LociOiling's troponin-C from puzzle 855.

110: Turkey is a revisiting puzzle, originally presented as Puzzle 110: Turkey in 2008.

The protein in this puzzle is a component of troponin, a muscle protein, from Meleagris gallopavo, a species which includes both domestic and wild turkeys.

The same troponin component, troponin C, is seen in the Calcium Ion Binding Protein revisiting puzzle.

The puzzle protein has 76 segments with the sequence:

aflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsgtidfeeflvmmvrqmk

(In the Calcium Ion Binding Protein puzzle, the protein includes the additional segments "qaear" at the start.)

This sequence is found in this Protein Data Bank entries:

  • 5TNC (chain A, offset 11)
  • 4TNC (chain A, offset 11)
  • 2W4U (chains 0, 3, 6, 9, offset 8)
  • 2W49 (chains 0, 3, 6, 9, offset 8)
  • 1ZAC (chain A, offset 11)
  • 1YV0 (chain C, offset 11)
  • 1YTZ (chain C, offset 11)
  • 1TOP (chain A, offset 11)
  • 1TNX (chain A, offset 11)
  • 1TNW (chain A, offset 11)
  • 1TNQ (chain A, offset 11)

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
110: Turkey 12/03/08 9,608 Steven Pletsch 9,676 ferzle 9,676 Another Hour Another Point
855: Revisiting Puzzle 110: Turkey 03/12/14 9,634 LociOiling 9,635 smilingone 9,635 Beta Folders
1156: Revisiting Puzzle 110: Turkey 11/18/15 9,364 BitSpawn 9,366 Galaxie 9,366 Anthropic Dreams
1376: Revisiting Puzzle 110: Turkey 05/11/17 9,317 Bruno Kestemont 9,317 Bruno Kestemont 9,317 Go Science Hat trick!
1639: Revisiting Puzzle 110: Turkey 02/20/19 10,630 Aubade01 10,549 LociOiling 10,549 Beta Folders
1819: Revisiting Puzzle 110: Turkey 04/08/20 10,577 HerobrinesArmy 10,570 Bletchley Park 10,577 Herobrine's Army
Community content is available under CC-BY-SA unless otherwise noted.