Revisiting puzzle/109: Pumpkin

tokens' trypsin inhibitor from puzzle 1374.

109: Pumpkin is a revisiting puzzle, originally presented as Puzzle 109: Pumpkin in 2008.

The protein in this puzzle is from Cucurbita maxima, a species which includes many types of pumpkins and squashes. The protein is a trypsin inhibitor, which blocks the enzyme trypsin. Trypsin breaks down proteins. Trypsin inhibitors in general can interfere with digestion of proteins, but the puzzle protein has a specific inhibitory effect on human blood coagulation factor beta-factor XIIa.

The puzzle protein has 44 segments with the sequence:

sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk

This sequence is found in this Protein Data Bank entries:

1TIN (chain A, offset 1)
1MIT (chain A, offset 1)
1HYM (chain A, offset 1)

The complete protein can have one disulfide bridge, identified in 1MIT as 3-48. In the Foldit puzzle, only 44 segments are present, so there's only one cysteine, and no disulfide bridge can form.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle	closed	top solo score	top solo	top evo score	top evo	top group score	top group	comments
109: Pumpkin
109: Pumpkin	12/01/08	8,986	MellyLam	8,934	Rhyslarm	8,986	Another Hour Another Point
850: Revisiting Puzzle 109: Pumpkin	03/05/14	8,821	smilingone	8,822	LociOiling	8,822	Beta Folders
1154: Revisiting Puzzle 109: Pumpkin	11/11/15	8,538	WarpSpeed	8,534	O Seki To	8,534	Hun-Magyar Csapat
1374: Revisiting Puzzle 109: Pumpkin	05/04/17	8,626	gitwut	8,624	georg137	8,626	Contenders
1636: Revisiting Puzzle 109: Pumpkin	02/20/19	9,250	gdnskye	9,253	Galaxie	9,253	Anthropic Dreams
1816: Revisiting Puzzle 109: Pumpkin	04/01/20	9,246	Galaxie	9,245	Galaxie	9,256	Anthropic Dreams	Hat trick, Galaxie!
2095: Revisiting Puzzle 109: Pumpkin	01/20/22	9,322	grogar7	9,321	Galaxie	9,322	Anthropic Dreams

Revisiting puzzle/109: Pumpkin

Fan Feed