FANDOM


Irc 370468 1494711430 S2 tokens 8617

tokens' trypsin inhibitor from puzzle 1374.

109: Pumpkin is a revisiting puzzle, originally presented as Puzzle 109: Pumpkin in 2008.

The protein in this puzzle is from Cucurbita maxima, a species which includes many types of pumpkins and squashes. The protein is a trypsin inhibitor, which blocks the enzyme trypsin. Trypsin breaks down proteins. Trypsin inhibitors in general can interfere with digestion of proteins, but the puzzle protein has a specific inhibitory effect on human blood coagulation factor beta-factor XIIa.

The puzzle protein has 44 segments with the sequence:

sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk

This sequence is found in this Protein Data Bank entries:

  • 1TIN (chain A, offset 1)
  • 1MIT (chain A, offset 1)
  • 1HYM (chain A, offset 1)

The complete protein can have one disulfide bridge, identified in 1MIT as 3-48. In the Foldit puzzle, only 44 segments are present, so there's only one cysteine, and no disulfide bridge can form.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.