
tokens' trypsin inhibitor from puzzle 1374.
109: Pumpkin is a revisiting puzzle, originally presented as Puzzle 109: Pumpkin in 2008.
The protein in this puzzle is from Cucurbita maxima, a species which includes many types of pumpkins and squashes. The protein is a trypsin inhibitor, which blocks the enzyme trypsin. Trypsin breaks down proteins. Trypsin inhibitors in general can interfere with digestion of proteins, but the puzzle protein has a specific inhibitory effect on human blood coagulation factor beta-factor XIIa.
The puzzle protein has 44 segments with the sequence:
sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk
This sequence is found in this Protein Data Bank entries:
The complete protein can have one disulfide bridge, identified in 1MIT as 3-48. In the Foldit puzzle, only 44 segments are present, so there's only one cysteine, and no disulfide bridge can form.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
109: Pumpkin | ||||||||
109: Pumpkin | 12/01/08 | 8,986 | MellyLam | 8,934 | Rhyslarm | 8,986 | Another Hour Another Point | |
850: Revisiting Puzzle 109: Pumpkin | 03/05/14 | 8,821 | smilingone | 8,822 | LociOiling | 8,822 | Beta Folders | |
1154: Revisiting Puzzle 109: Pumpkin | 11/11/15 | 8,538 | WarpSpeed | 8,534 | O Seki To | 8,534 | Hun-Magyar Csapat | |
1374: Revisiting Puzzle 109: Pumpkin | 05/04/17 | 8,626 | gitwut | 8,624 | georg137 | 8,626 | Contenders | |
1636: Revisiting Puzzle 109: Pumpkin | 02/20/19 | 9,250 | gdnskye | 9,253 | Galaxie | 9,253 | Anthropic Dreams | |
1816: Revisiting Puzzle 109: Pumpkin | 04/01/20 | 9,246 | Galaxie | 9,245 | Galaxie | 9,256 | Anthropic Dreams | Hat trick, Galaxie! |
2095: Revisiting Puzzle 109: Pumpkin | 01/20/22 | 9,322 | grogar7 | 9,321 | Galaxie | 9,322 | Anthropic Dreams |