tokens' trypsin inhibitor from puzzle 1374.
109: Pumpkin is a revisiting puzzle, originally presented as Puzzle 109: Pumpkin in 2008.
The protein in this puzzle is from Cucurbita maxima, a species which includes many types of pumpkins and squashes. The protein is a trypsin inhibitor, which blocks the enzyme trypsin. Trypsin breaks down proteins. Trypsin inhibitors in general can interfere with digestion of proteins, but the puzzle protein has a specific inhibitory effect on human blood coagulation factor beta-factor XIIa.
The puzzle protein has 44 segments with the sequence:
sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk
This sequence is found in this Protein Data Bank entries:
The complete protein can have one disulfide bridge, identified in 1MIT as 3-48. In the Foldit puzzle, only 44 segments are present, so there's only one cysteine, and no disulfide bridge can form.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
