Foldit Wiki
Advertisement

tokens' trypsin inhibitor from puzzle 1374.

109: Pumpkin is a revisiting puzzle, originally presented as Puzzle 109: Pumpkin in 2008.

The protein in this puzzle is from Cucurbita maxima, a species which includes many types of pumpkins and squashes. The protein is a trypsin inhibitor, which blocks the enzyme trypsin. Trypsin breaks down proteins. Trypsin inhibitors in general can interfere with digestion of proteins, but the puzzle protein has a specific inhibitory effect on human blood coagulation factor beta-factor XIIa.

The puzzle protein has 44 segments with the sequence:

sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk

This sequence is found in this Protein Data Bank entries:

  • 1TIN (chain A, offset 1)
  • 1MIT (chain A, offset 1)
  • 1HYM (chain A, offset 1)

The complete protein can have one disulfide bridge, identified in 1MIT as 3-48. In the Foldit puzzle, only 44 segments are present, so there's only one cysteine, and no disulfide bridge can form.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
109: Pumpkin
109: Pumpkin 12/01/08 8,986 MellyLam 8,934 Rhyslarm 8,986 Another Hour Another Point
850: Revisiting Puzzle 109: Pumpkin 03/05/14 8,821 smilingone 8,822 LociOiling 8,822 Beta Folders
1154: Revisiting Puzzle 109: Pumpkin 11/11/15 8,538 WarpSpeed 8,534 O Seki To 8,534 Hun-Magyar Csapat
1374: Revisiting Puzzle 109: Pumpkin 05/04/17 8,626 gitwut 8,624 georg137 8,626 Contenders
1636: Revisiting Puzzle 109: Pumpkin 02/20/19 9,250 gdnskye 9,253 Galaxie 9,253 Anthropic Dreams
1816: Revisiting Puzzle 109: Pumpkin 04/01/20 9,246 Galaxie 9,245 Galaxie 9,256 Anthropic Dreams Hat trick, Galaxie!
2095: Revisiting Puzzle 109: Pumpkin 01/20/22 9,322 grogar7 9,321 Galaxie 9,322 Anthropic Dreams
Advertisement