FANDOM


Peak6 01

The Peak6 protein, as seen in the Foldit protein design paper.

Peak6 is the fourth solved Foldit design, originally created by fiendish_ghoul in Puzzle 1331.

Peak6 is one of the four solved designs mentioned in the Foldit protein design paper in 2019.

The protein appears in the PDB as 6MRS.

Peak6 has 75 segments with the primary structure:

grqekvlksieetvrkmgvtmethrsgnevkvvikglhesqqeqlkkdveetskkqgvetriefhgdtvtivvre
Community content is available under CC-BY-SA unless otherwise noted.