FANDOM


Foldit1 01

The Foldit1 protein, as seen in the Foldit protein design paper.

Foldit1 is the first solved Foldit design, originally created in Puzzle 1297. The protein was designed by the Foldit team Anthropic Dreams.

Foldit1 is one of the four solved designs mentioned in the Foldit protein design paper in 2019.

The protein appears in the PDB as 6MRR.

Foldit1 has 65 segments with the primary structure:

telekhreelkeflkkegitnveiridngrlevrveggterlkrfleelrqklekkgytvdikie
Community content is available under CC-BY-SA unless otherwise noted.